DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and cish

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_001070085.1 Gene:cish / 767678 ZFINID:ZDB-GENE-050907-1 Length:212 Species:Danio rerio


Alignment Length:220 Identity:66/220 - (30%)
Similarity:97/220 - (44%) Gaps:40/220 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   800 PLPKKALPFTAAAYAIEAVKSEPEEVKTNAIQEPRALQFTSSIEKVKDYGWYWGPLSSEAAEKVL 864
            |.|:..|||::....     .||.....:|.::.|||  |.:...:...|||||.:|:..|..||
Zfish     8 PSPRALLPFSSPRRI-----DEPFLTIEDASKDYRAL--TLNFSYLDASGWYWGGISASEAHSVL 65

  Fly   865 SSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGS------------------- 910
            ....:|:|::||||...|:.:||.|......:||||..|..||..|                   
Zfish    66 KGASEGTFLIRDSSHPDYMLTLSVKTVRGPTNVRIEYRQCRFSLDSSSPARSHLQSFPDVHSLVQ 130

  Fly   911 -YAKFKSQTITEFIEKAVEHSRSGRYLFFLHRRPEHGPMRVQLTNPVSRFKHVQSLQHMCRFVIL 974
             |...||:...|.:|:| .|        .:...|:...:.::|..|:...:...||:|:.|.||.
Zfish   131 HYVGSKSEKNEEKMEEA-HH--------VISSAPKECSVLLKLKKPIHCPQGFPSLKHLTRLVIN 186

  Fly   975 KAVIRKDLIQTLPLPRRLLDYL-NY 998
            |.....::   ||||..||.|| ||
Zfish   187 KHTSSTEM---LPLPNPLLYYLQNY 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 35/117 (30%)
SOCS_SOCS7 960..1009 CDD:239710 17/40 (43%)
cishNP_001070085.1 SH2_CIS 46..133 CDD:198285 27/86 (31%)
SOCS 175..212 CDD:295349 17/37 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.