DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and socs2

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:XP_005164804.1 Gene:socs2 / 562062 ZFINID:ZDB-GENE-041210-171 Length:198 Species:Danio rerio


Alignment Length:190 Identity:59/190 - (31%)
Similarity:98/190 - (51%) Gaps:17/190 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   816 EAVKSEPEEVKTNAIQEPRALQFTSSIEKVKD-YGWYWGPLSSEAAEKVLSSEPDGSFIVRDSSD 879
            |::::|........:.:....:..:::..:|: .|||||.|::..|:::|....:|:|:|||||.
Zfish    10 ESIENERRSQSETQVADTEQSRIATAMRDLKNTAGWYWGSLTANEAKEILQDTSEGTFLVRDSSQ 74

  Fly   880 DHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAKFKSQ-----TITEFIEKAVEHSRS---GRYL 936
            ..|:|::|...:....::|||...|.|...|....|.:     ::...:|..|:.||:   ||  
Zfish    75 RDYLFTISAMTSAGPTNLRIEYKDGKFKLDSVVLVKPKLKQFDSVVHLVEHYVQLSRTSCKGR-- 137

  Fly   937 FFLHRRPEHGPMRVQLTNPVSRFKHVQSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYL 996
             .....|.:|.:::.||.||  :....||||:||..|.|...|   :|.||||.||.|||
Zfish   138 -TNQIAPSNGTVQLLLTTPV--YTATPSLQHLCRIAINKTTRR---VQELPLPNRLKDYL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 32/106 (30%)
SOCS_SOCS7 960..1009 CDD:239710 19/37 (51%)
socs2XP_005164804.1 SH2 36..139 CDD:301589 32/105 (30%)
SOCS_SOCS2 158..198 CDD:239705 19/37 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.