DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and socs6

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:XP_687041.2 Gene:socs6 / 558703 -ID:- Length:519 Species:Danio rerio


Alignment Length:269 Identity:100/269 - (37%)
Similarity:138/269 - (51%) Gaps:35/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   762 GAAGQTQLASEL------NGTLITAEADEP-----NADLRKKFQSRALPPLPKKALPFT------ 809
            |..|...:.|::      ||.|    ||.|     |:.......|.:|.||....:|.|      
Zfish   255 GPDGHDIITSDILMEHSVNGHL----ADAPAMVLSNSRADTPLFSPSLSPLSTNDIPRTLSGFSS 315

  Fly   810 AAAYAIEAVK--------SEPEEVKT-NAIQEPRALQFTSSIEKVK---DYGWYWGPLSSEAAEK 862
            |.::.:|.|:        |.|...:. ::.|....:..||..|::|   ..||||||::...||:
Zfish   316 ADSHVVERVRHHLNFDPNSAPGVSRVYDSFQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEE 380

  Fly   863 VLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAKFKSQT-ITEFIEKA 926
            .|.:.|||||:|||||||.|:.||||:......|.|||...|.|||......:..| |.:.||.:
Zfish   381 KLVNLPDGSFLVRDSSDDRYLLSLSFRSQGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHS 445

  Fly   927 VEHSRSGRYLFFLHRRPEHGPMRVQLTNPVSRFKHVQSLQHMCRFVILKAVIRKDLIQTLPLPRR 991
            ::.|.:|.:.:...|.|......|:||||||||..|:|||::||||| :...|.||||.||||.:
Zfish   446 IKDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVI-RQYTRIDLIQKLPLPNK 509

  Fly   992 LLDYLNYKH 1000
            :.|||..||
Zfish   510 MKDYLQEKH 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 44/101 (44%)
SOCS_SOCS7 960..1009 CDD:239710 23/41 (56%)
socs6XP_687041.2 SH2_SOCS6 357..456 CDD:198250 42/98 (43%)
SOCS_SOCS6 479..519 CDD:239709 23/41 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8888
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25935
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10155
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3554
SonicParanoid 1 1.000 - - X1970
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.