DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and Socs5

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_001102744.1 Gene:Socs5 / 500616 RGDID:1564914 Length:536 Species:Rattus norvegicus


Alignment Length:432 Identity:99/432 - (22%)
Similarity:155/432 - (35%) Gaps:127/432 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   682 EHHNQHQPPNNKHVLHSEKKSQFTLNLKQRFCSIFRFRRSNHSRCRGSGNNQTGTFASANANAAA 746
            :.:::|.|...|.......|:|.:|:.:::|   .|.|.....|.|..|.:......|.::.|..
  Rat   112 DSYSRHAPWGGKKKHSCSTKTQSSLDTEKKF---GRTRSGLQRRERRYGVSSMHDMDSVSSRAVG 173

  Fly   747 ----------TAPLIPPI---------------------AVITSAPGAAGQTQLASE-------- 772
                      |..|..|:                     .::...|..|| :.||.:        
  Rat   174 SRSLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAG-SDLAQKWHLIKQHT 237

  Fly   773 ------------LNGTLITAEADE------------------PNADLRKKFQSRALPPL----PK 803
                        .:.:|::.|.:|                  |||.:.....:..:.||    ||
  Rat   238 APVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLGPK 302

  Fly   804 KALPFTAAA---YAIEAVKSEPEEVKTNAI-----QEPRALQFTSSIEKVKDYGW---------- 850
            .|...|..:   .||.....:.||..|...     |:.|.:...|.....:...|          
  Rat   303 LAPGMTEISGDGSAIPQTNCDSEEDSTTLCLQSRRQKQRQVSGDSHSHISRQGAWKVHTQIDYIH 367

  Fly   851 --------------YWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQ 901
                          |||.:....||.:|..:|:|:|::|||:.:.|:||:||:..|...|.||||
  Rat   368 CLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYNRSLHARIEQ 432

  Fly   902 DQGTFSFGSY--AKFKSQTITEFIEKAVEHSRSGRYLFFLHRRPEHGPMRVQLTNPVSRFKHVQS 964
            ....|||.::  ..|.|.|:|..:|...:.|..   :||       .|:.....|....|    |
  Rat   433 WNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSC---MFF-------EPLLTISLNRTFPF----S 483

  Fly   965 LQHMCRFVILKAVIRKDLIQTLPLPRRLLDYLNYKHCYSEQV 1006
            ||::||.||.:.. ..|.|..||||..|.|:|...| |.::|
  Rat   484 LQYICRAVICRCT-TYDGIDGLPLPSMLQDFLKEYH-YKQKV 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 34/123 (28%)
SOCS_SOCS7 960..1009 CDD:239710 19/47 (40%)
Socs5NP_001102744.1 SOCS 146..195 CDD:289383 9/48 (19%)
SH2 370..470 CDD:301589 34/109 (31%)
SOCS_SOCS5 479..534 CDD:239708 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.