DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and Sla2

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_001165589.1 Gene:Sla2 / 499931 RGDID:1562071 Length:263 Species:Rattus norvegicus


Alignment Length:180 Identity:41/180 - (22%)
Similarity:68/180 - (37%) Gaps:53/180 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   797 ALPPLPKKALPFTAAAYA---IEAVKSEPEEVKTNAIQ-----------------EP-------- 833
            :||...|.:.|.::::::   .|.|..:.|..|.:|:.                 ||        
  Rat     4 SLPSRGKNSSPSSSSSFSGPGQEPVSIQAERQKVSAVALGSFPAGEQARLSLRVGEPLTIISEDG 68

  Fly   834 -----------RALQFTSSIEKVKDYGWYWGPLSSEAAEK--VLSSEPDGSFIVRDSSDDHYIFS 885
                       |.....|.......:||.:..||.|.||:  :|...|.|:|::|:|......:|
  Rat    69 DWWTVQSEVSGREYHIPSVYVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGCYS 133

  Fly   886 LSFKLN-----NCVRHVRIEQ-DQGTFSFGSYAKFKSQTITEFIEKAVEH 929
            ||.:|:     :.:||.||:: |.|.........|.|      :...|||
  Rat   134 LSIRLSRPASWDRIRHYRIQRLDNGWLYISPRLTFPS------LHALVEH 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 29/99 (29%)
SOCS_SOCS7 960..1009 CDD:239710
Sla2NP_001165589.1 SH3 39..92 CDD:302595 5/52 (10%)
SH2_SLAP 85..187 CDD:198207 29/99 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.