DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and socs3l

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_988992.1 Gene:socs3l / 394588 XenbaseID:XB-GENE-5809273 Length:211 Species:Xenopus tropicalis


Alignment Length:165 Identity:47/165 - (28%)
Similarity:91/165 - (55%) Gaps:16/165 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   840 SSIEKVKDYGWYWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQG 904
            :::|:::..|:||..||...|:|:||.:|.|||::|||||.|::|:||.:.:..:.::||:.:..
 Frog    45 TALERLEASGYYWSTLSGTEAKKLLSDQPVGSFLIRDSSDHHHLFTLSLRTSAGITNLRIKLEGP 109

  Fly   905 TFSFGSYAKFKSQTITEFIEKAVEH-------SRSGRYLFFLHRRPEHGPMRVQLTNPVSRFKHV 962
            :|...:.|..:|......:.|.|||       ..|...|.::....:  |:.:.||.|::  ..|
 Frog   110 SFYLETVAGAESPHTFPCVVKLVEHYMRLTAAGE
SDSNLCYIEGNDQ--PVPLMLTQPLN--CKV 170

  Fly   963 QSLQHMCRFVIL-----KAVIRKDLIQTLPLPRRL 992
            .|||::|:..::     :|....:.::.||:.:.|
 Frog   171 VSLQYLCKRTVVANMPAEASSSGENMEELPVSKML 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 33/103 (32%)
SOCS_SOCS7 960..1009 CDD:239710 9/38 (24%)
socs3lNP_988992.1 SH2_SOCS3 44..143 CDD:198247 32/97 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.