DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and socs3a

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_956244.1 Gene:socs3a / 335409 ZFINID:ZDB-GENE-030131-7349 Length:207 Species:Danio rerio


Alignment Length:203 Identity:59/203 - (29%)
Similarity:104/203 - (51%) Gaps:36/203 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   806 LPFTAAAYAIEAVKSEPEEVKTNAIQEPRALQFTSSIEKVKDYGWYWGPLSSEAAEKVLSSEPDG 870
            |||    |..:...|   :|:...:|.        :|..:::.|:|||.:|.:.|..:|||||.|
Zfish    22 LPF----YHFKTFSS---KVQFQLVQH--------TIRMLQESGFYWGAISGKEANHLLSSEPSG 71

  Fly   871 SFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAKFKSQTITEF--IEKAVEH--SR 931
            :|:||||||:.:.|:||.|..:..:::|::.|..:|...:.:| ..|::..|  :.:.|:|  .|
Zfish    72 TFLVRDSSDNRHFFTLSVKTESGTKNLRVQCDNKSFFLQTDSK-SMQSVPRFDCVLRLVQHYMPR 135

  Fly   932 SG------RYLFFLHRRPEHGPMRVQLTNPVSRFKHVQSLQHMCRFVILKAVIRKDLIQTL--PL 988
            |.      |..::::...|..|:  :|..|:.  ..:.||||:||    |.|.....:.:.  .|
Zfish   136 SALSIGIPRSSYYIYTGGEKIPL--ELLRPLQ--CSMSSLQHLCR----KTVNGHTDVSSKREHL 192

  Fly   989 PRRLLDYL 996
            |::|.|:|
Zfish   193 PQQLKDFL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 35/107 (33%)
SOCS_SOCS7 960..1009 CDD:239710 13/39 (33%)
socs3aNP_956244.1 SH2_SOCS3 40..139 CDD:198247 35/107 (33%)
SOCS 167..207 CDD:295349 13/38 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.