DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and Pi3K21B

DIOPT Version :10

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_477270.2 Gene:Pi3K21B / 33203 FlyBaseID:FBgn0020622 Length:496 Species:Drosophila melanogaster


Alignment Length:176 Identity:42/176 - (23%)
Similarity:79/176 - (44%) Gaps:26/176 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   850 WYWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAKF 914
            ||||.:|.|.|:.:|..:|||||:|||:......::|:...:.|.:.::|......:.|.....|
  Fly    22 WYWGRISREEAKSILHGKPDGSFLVRDALSMKGEYTLTLMKDGCEKLIKICHMDRKYGFIETDLF 86

  Fly   915 KSQTITEFIEKAVEHSRSGRYLFFLHRRPEHGPMRVQLTNPVSRFKHVQSLQ---HMCRFVILKA 976
            .|  :.|.|....|:|.|      ::.:    .:.:.|:||:.|.:..:..|   .:|       
  Fly    87 NS--VVEMINYYKENSLS------MYNK----TLDITLSNPIVRAREDEESQPHGDLC------- 132

  Fly   977 VIRKDLIQTLPLPRRLLDYLNYK----HCYSEQVESDSSHSQISGD 1018
            ::..:.|:|..|.:.|...|..|    :...|:::....|..:.|:
  Fly   133 LLSNEFIRTCQLLQNLEQNLENKRNSFNAIREELQEKKLHQSVFGN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 27/86 (31%)
SOCS_SOCS7 960..1009 CDD:239710 9/55 (16%)
Pi3K21BNP_477270.2 SH2_nSH2_p85_like 14..123 CDD:198195 31/112 (28%)
PI3K_P85_iSH2 120..303 CDD:465121 11/66 (17%)
SH2_cSH2_p85_like 320..422 CDD:198184
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.