DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and Socs4

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_001100726.1 Gene:Socs4 / 305828 RGDID:1306503 Length:436 Species:Rattus norvegicus


Alignment Length:403 Identity:97/403 - (24%)
Similarity:160/403 - (39%) Gaps:95/403 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   642 GGKYLSKQNKHNLDNDKLNN---NNNNNNNHQP----------SQQQLEKPPTEHHNQHQPPNN- 692
            |.::|.:..|..| .|.:..   ..|....|.|          |:..|:|.|      ..||:: 
  Rat    80 GHRFLGRSLKQKL-QDAVGQCFPIRNCGARHSPGLPSKRTIHISELMLDKCP------FPPPSDL 137

  Fly   693 --------KH--VLHSEKKSQFTLNLKQRFCSIFRFRRSNHSRCRGSGNNQTGTFASANANAAAT 747
                    :|  .|.|......:.:|.:|       |..:....|.|..:....|:..:      
  Rat   138 AFRWHFIKRHTVALSSSSDEWVSTDLCER-------RPRDAQLKRRSTEDDIPCFSHTS------ 189

  Fly   748 APLIPPIAVITSAPGAAGQTQLASELNGTLITAEADEPNADLRKKFQSRALPPLPKKALPFTAAA 812
               :.|..:.|::...||.....|.:|  |:|..:.| :.|:..:.:...|....:|        
  Rat   190 ---VQPCVITTNSASCAGGHVTGSLMN--LVTDNSME-DGDMDSEDEIITLCTSSRK-------- 240

  Fly   813 YAIEAVKSEPE-EVKTNAIQEPRALQFTSSIE----------KVKDYGWYWGPLSSEAAEKVLSS 866
                  :::|. |.....:|.....:|.:.|:          ::.:...|||.:...|||.:|..
  Rat   241 ------RNKPRWETDDGILQLEAPPKFHTQIDYVHCLVPDLLQISNNPCYWGVMDKYAAEALLEG 299

  Fly   867 EPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSY--AKFKSQTITEFIEKAVEH 929
            :|:|:|::|||:.:.|:||:||:..:...|.||||....|||.::  ..|.|..||..:|...:.
  Rat   300 KPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDP 364

  Fly   930 SRSGRYLFFLHRRPEHGPMRVQLTNPVSR-FKHVQSLQHMCRFVILKAVIRKDLIQTLPLPRRLL 993
            |..   :||       .|:   |:.|:.| |..  ||||:||.||.... ..|.|..||:|..:.
  Rat   365 SAC---MFF-------EPL---LSTPLIRTFPF--SLQHICRTVICNCT-TYDGIDALPIPSPMK 413

  Fly   994 DYLNYKHCYSEQV 1006
            .||...| |..:|
  Rat   414 LYLKEYH-YKSKV 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 33/109 (30%)
SOCS_SOCS7 960..1009 CDD:239710 18/47 (38%)
Socs4NP_001100726.1 SOCS 58..105 CDD:289383 5/25 (20%)
SH2_SOCS4 272..372 CDD:198248 34/109 (31%)
SOCS 381..436 CDD:295349 19/49 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.