DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and Tnp2

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_058753.2 Gene:Tnp2 / 24840 RGDID:3885 Length:114 Species:Rattus norvegicus


Alignment Length:96 Identity:23/96 - (23%)
Similarity:41/96 - (42%) Gaps:18/96 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   652 HNLDNDKLNNNNNNNNNH---------QPSQQQLEK--PPTEH-----HNQHQPPNNKHVLHSEK 700
            |:....:.:.||....:|         .||......  |||:|     |:::.|....| ..|..
  Rat    16 HSSSRPQSHTNNQCACSHHCRSCSQAGHPSSSSSPSSGPPTKHPKTPMHSRYSPSRPSH-RGSCP 79

  Fly   701 KSQFTLNLK-QRFCSIFRFRRSNHSRCRGSG 730
            |::.||..| .:..::.|.:|::.::.|.||
  Rat    80 KNRKTLEGKVSKRKAVRRRKRTHRAKRRSSG 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251
SOCS_SOCS7 960..1009 CDD:239710
Tnp2NP_058753.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114 23/96 (24%)
TP2 1..110 CDD:279579 21/94 (22%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:10961985 87..95 1/7 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.