DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and Tnp2

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_038722.3 Gene:Tnp2 / 21959 MGIID:98785 Length:117 Species:Mus musculus


Alignment Length:95 Identity:19/95 - (20%)
Similarity:26/95 - (27%) Gaps:32/95 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 PLGHTS----------HCHYHHSHGHG-------------HGSHHHHHHHQPGYGYSHGQRPNSR 414
            |..|||          ||......||.             |.....|..|.|......|..|.:|
Mouse    21 PQSHTSNQCNQCTCSHHCRSCSQAGHAGSSSSPSPGPPMKHPKPSVHSRHSPARPSHRGSCPKNR 85

  Fly   415 NSLNSRLSS---------SHNSLNVSSANK 435
            .:...::|.         :|.:...||..:
Mouse    86 KTFEGKVSKRKAVRRRKRTHRAKRRSSGRR 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251
SOCS_SOCS7 960..1009 CDD:239710
Tnp2NP_038722.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..117 19/95 (20%)
TP2 1..113 CDD:279579 18/91 (20%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:P11101 90..98 1/7 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.