DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and Socs2

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:XP_017169385.1 Gene:Socs2 / 216233 MGIID:1201787 Length:267 Species:Mus musculus


Alignment Length:206 Identity:62/206 - (30%)
Similarity:97/206 - (47%) Gaps:33/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   822 PEEVKTNAIQEPRALQFTSSIEKVKDYGWYWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSL 886
            |||      |.|.|.:...::.::...|||||.::...|::.|...|:|:|::||||...|:.::
Mouse    26 PEE------QSPEAARLAKALRELSQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTI 84

  Fly   887 SFKLNNCVRHVRIEQDQGTFSFGSYAKFKSQ-----TITEFIEKAVE---HSRSGRYLFFLHRRP 943
            |.|.:....::|||...|.|...|....||:     ::...|:..|:   ..|:|      ...|
Mouse    85 SVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTG------PEAP 143

  Fly   944 EHGPMRVQLTNPVSRFKHVQSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYL-NYKHCYSEQVE 1007
            .:|.:.:.||.|:  :....:|||.||..|.|..   ..|..||||.||.||| .||.       
Mouse   144 RNGTVHLYLTKPL--YTSAPTLQHFCRLAINKCT---GTIWGLPLPTRLKDYLEEYKF------- 196

  Fly  1008 SDSSHSQISGD 1018
            .::..|::.||
Mouse   197 QENQGSEMLGD 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 29/105 (28%)
SOCS_SOCS7 960..1009 CDD:239710 19/49 (39%)
Socs2XP_017169385.1 SH2_SOCS2 40..142 CDD:198246 29/107 (27%)
SOCS 158..197 CDD:383010 19/48 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.