DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and F39B2.5

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_493574.2 Gene:F39B2.5 / 185487 WormBaseID:WBGene00009556 Length:192 Species:Caenorhabditis elegans


Alignment Length:173 Identity:54/173 - (31%)
Similarity:93/173 - (53%) Gaps:13/173 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   847 DYGWYWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSY 911
            |..||||.|..:.||::|...|.|.|::|||..:.::|::|:...:.|.|.|:..:....:.||.
 Worm    13 DCDWYWGDLDWKWAERLLLLCPIGYFLIRDSRSETHLFTVSYHFQDRVYHSRLSLEDSRRNLGSR 77

  Fly   912 AKFKSQ---TITEFIEKAVEHSRSGRYLFFLHRR-PEHGPMRVQLTNPVSRFKHVQSLQHMCRFV 972
            ..:.|:   .:.|.||:::|.|.:|:.....:|| .|....||.||.|:::.:.:.|||::|||.
 Worm    78 QPYVSRDYWNLVEIIERSLEQSLTGQQEM
LHYRRGHEAEAARVNLTRPLTKRELLPSLQYLCRFT 142

  Fly   973 ILKAVIRKDLIQTLPLPRRLLDYL--------NYKHCYSEQVE 1007
            :..:..:....:|.|||..:|.||        :.|.| .||::
 Worm   143 LKTSQQKPPTPKTAPLPPTILKYLSDSKWIIPDLKKC-EEQLK 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 29/92 (32%)
SOCS_SOCS7 960..1009 CDD:239710 17/56 (30%)
F39B2.5NP_493574.2 SH2_SOCS7 5..106 CDD:198251 29/92 (32%)
SOCS 126..169 CDD:128549 13/42 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158640
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006587
OrthoInspector 1 1.000 - - oto17866
orthoMCL 1 0.900 - - OOG6_119325
Panther 1 1.100 - - LDO PTHR10155
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3554
SonicParanoid 1 1.000 - - X1970
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.