DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and Socs3

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_031733.1 Gene:Socs3 / 12702 MGIID:1201791 Length:225 Species:Mus musculus


Alignment Length:189 Identity:48/189 - (25%)
Similarity:91/189 - (48%) Gaps:39/189 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   840 SSIEKVKDYGWYWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQG 904
            :::.|:::.|:||..::...|..:||:||.|:|::|||||..:.|:||.|..:..:::||:.:.|
Mouse    36 NAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGG 100

  Fly   905 TFSFGSYAKFKSQTITEF--IEKAVEH-------------------------------SRSGRYL 936
            :||..|..: .:|.:..|  :.|.|.|                               ..:.:..
Mouse   101 SFSLQSDPR-STQPVPRFDCVLKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRA 164

  Fly   937 FFLHRRPEHGPMRVQLTNPVSRFKHVQSLQHMCRFVILKAVIRKDLIQTLPLP-RRLLD 994
            ::::...|..|:  .|:.|:|  .:|.:|||:||..:...:...:.:..||.| |..||
Mouse   165 YYIYSGGEKIPL--VLSRPLS--SNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLD 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 31/129 (24%)
SOCS_SOCS7 960..1009 CDD:239710 12/36 (33%)
Socs3NP_031733.1 Kinase inhibitory region (KIR) 22..33
Extended SH2 subdomain (ESS) 34..45 1/8 (13%)
SH2_SOCS3 35..135 CDD:198247 31/99 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..160 0/28 (0%)
SOCS_SOCS3 184..225 CDD:239706 12/36 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.