DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and SOCS4

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_543143.1 Gene:SOCS4 / 122809 HGNCID:19392 Length:440 Species:Homo sapiens


Alignment Length:397 Identity:93/397 - (23%)
Similarity:157/397 - (39%) Gaps:83/397 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   642 GGKYLSKQNKHNLDND-----KLNNNNNNNNNHQPSQQQ-------LEKPPTEHHNQHQPPNN-- 692
            |.::|.:..|..|.:.     .:.|.::.:::..||:::       |:|.|.       ||.:  
Human    83 GHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKRKIHISELMLDKCPF-------PPRSDL 140

  Fly   693 --------KHV--LHSEKKSQFTLNLKQRFCSIFRFRRSN---HSRCRGSGNNQTGTFASANANA 744
                    :|.  ::|:.....:.:|.|......:.:|.|   :..|....|.|.....:.|| .
Human   141 AFRWHFIKRHTAPINSKSDEWVSTDLSQTELRDGQLKRRNMEENINCFSHTNVQPCVITTDNA-L 204

  Fly   745 AATAPLIPPIAVITSAPGAAGQTQLASELNGTLITA--EADEPNADLRKKFQSRALPPLPKKALP 807
            ....|:...:..:.|..........:.:...||.|:  :.::|..||..:......||.....:.
Human   205 CREGPMTGSVMNLVSNNSIEDSDMDSDDEILTLCTSSRKRNKPKWDLDDEILQLETPPKYHTQID 269

  Fly   808 FTAAAYAIEAVKSEPEEVKTNAIQEPRALQFTSSIEKVKDYGWYWGPLSSEAAEKVLSSEPDGSF 872
            :.....                   |..||       :.:...|||.:...|||.:|..:|:|:|
Human   270 YVHCLV-------------------PDLLQ-------INNNPCYWGVMDKYAAEALLEGKPEGTF 308

  Fly   873 IVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSY--AKFKSQTITEFIEKAVEHSRSGRY 935
            ::|||:.:.|:||:||:..:...|.||||....|||.::  ..|.|..||..:|...:.|..   
Human   309 LLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSAC--- 370

  Fly   936 LFFLHRRPEHGPMRVQLTNPVSR-FKHVQSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYLNYK 999
            :||       .|:   |:.|:.| |..  ||||:||.||.... ..|.|..||:|..:..||...
Human   371 MFF-------EPL---LSTPLIRTFPF--SLQHICRTVICNCT-TYDGIDALPIPSSMKLYLKEY 422

  Fly  1000 HCYSEQV 1006
            | |..:|
Human   423 H-YKSKV 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 32/99 (32%)
SOCS_SOCS7 960..1009 CDD:239710 18/47 (38%)
SOCS4NP_543143.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
SOCS 59..111 CDD:315310 5/27 (19%)
SH2_SOCS4 275..375 CDD:198248 37/135 (27%)
SOCS_SOCS4 384..439 CDD:239707 19/49 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.