Sequence 1: | NP_001259662.1 | Gene: | Socs16D / 32760 | FlyBaseID: | FBgn0030869 | Length: | 1021 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_037456.5 | Gene: | CISH / 1154 | HGNCID: | 1984 | Length: | 275 | Species: | Homo sapiens |
Alignment Length: | 238 | Identity: | 62/238 - (26%) |
---|---|---|---|
Similarity: | 99/238 - (41%) | Gaps: | 57/238 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 801 LPKKAL-PFTAAAYAIEAVKSEPEEVKTNAIQEPRALQ-------FTSSIEKVKDYGWYWGPLSS 857
Fly 858 EAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAKFKSQ----- 917
Fly 918 ----TITEFIEKAVEHSRSGRYLFFLHRRPEHGP-------------------------MRVQLT 953
Fly 954 NPVSRFKHVQSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYL 996 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Socs16D | NP_001259662.1 | SH2_SOCS7 | 839..937 | CDD:198251 | 27/106 (25%) |
SOCS_SOCS7 | 960..1009 | CDD:239710 | 19/37 (51%) | ||
CISH | NP_037456.5 | SH2_CIS | 94..181 | CDD:198285 | 25/86 (29%) |
SOCS_CIS1 | 235..275 | CDD:239703 | 19/37 (51%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4566 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.770 |