DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and CISH

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_037456.5 Gene:CISH / 1154 HGNCID:1984 Length:275 Species:Homo sapiens


Alignment Length:238 Identity:62/238 - (26%)
Similarity:99/238 - (41%) Gaps:57/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   801 LPKKAL-PFTAAAYAIEAVKSEPEEVKTNAIQEPRALQ-------FTSSIEKVKDYGWYWGPLSS 857
            |||..: |..|.|:..|..:..|.:.::    ||:.|.       ...:...:::.|||||.:::
Human    46 LPKPVMQPLPAGAFLEEVAEGTPAQTES----EPKVLDPEEDLLCIAKTFSYLRESGWYWGSITA 106

  Fly   858 EAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAKFKSQ----- 917
            ..|.:.|...|:|:|:||||:...|:|:||.|......:||||....:|...|....:.:     
Human   107 SEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFP 171

  Fly   918 ----TITEFIEKAVEHSRSGRYLFFLHRRPEHGP-------------------------MRVQLT 953
                .:..::......:||.        .|:..|                         :.::|.
Human   172 DVVSLVQHYVASCTADTRSD--------SPDPAPTPALPMPKEDAPSDPALPAPPPATAVHLKLV 228

  Fly   954 NPVSRFKHVQSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYL 996
            .|..|....:||||:||.||.:.|...|   .||||||:.|||
Human   229 QPFVRRSSARSLQHLCRLVINRLVADVD---CLPLPRRMADYL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 27/106 (25%)
SOCS_SOCS7 960..1009 CDD:239710 19/37 (51%)
CISHNP_037456.5 SH2_CIS 94..181 CDD:198285 25/86 (29%)
SOCS_CIS1 235..275 CDD:239703 19/37 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.