DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and cishb

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:XP_017213670.1 Gene:cishb / 100136861 ZFINID:ZDB-GENE-080204-120 Length:213 Species:Danio rerio


Alignment Length:200 Identity:59/200 - (29%)
Similarity:90/200 - (45%) Gaps:33/200 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   819 KSEPEEVKTNAIQEPRALQF-------TSSIEKVKDYGWYWGPLSSEAAEKVLSSEPDGSFIVRD 876
            ::|..|.:....|:.:|..:       |::.:.:...|||||.|::..|...|...|:|:|:|||
Zfish    18 QNERGESEVQQTQQHQAAPYSEDFHFITTTFQHLNTSGWYWGGLTAGDARAALIGAPEGTFLVRD 82

  Fly   877 SSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAKFKSQTIT-EFIEKAVEHSRSGRYLFFLH 940
            ||...|:|:||.:......::|||.|.|.|...|....:|..:: ..:...|.|..|.       
Zfish    83 SSHPLYLFTLSVQTWRGPTNIRIEYDSGRFRLDSSFPARSCLLSFSALPSLVHHYSSA------- 140

  Fly   941 RRPE-------HGPM-------RVQLTNPVSRFKHVQSLQHMCRFVILKAVIRKDLIQTLPLPRR 991
             |||       |..|       .::|..|:.|.:...:|||:.|..|.:   ..|....|||||.
Zfish   141 -RPEEEKKAEDHHHMVAKDTGILLKLRKPLHRPQAFPTLQHLTRLTINR---HTDCHTKLPLPRP 201

  Fly   992 LLDYL 996
            ||.||
Zfish   202 LLLYL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 32/98 (33%)
SOCS_SOCS7 960..1009 CDD:239710 14/36 (39%)
cishbXP_017213670.1 SH2_CIS 51..138 CDD:198285 30/86 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.