DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and HAT1

DIOPT Version :9

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_193476.1 Gene:HAT1 / 827457 AraportID:AT4G17460 Length:282 Species:Arabidopsis thaliana


Alignment Length:303 Identity:71/303 - (23%)
Similarity:115/303 - (37%) Gaps:95/303 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LNLSMD-APNPEISPNSVTNSSSVYMIRQMALIQQARVAAAAVAMQQQQQQQR-----------D 99
            |:||:. |.|..:..|....||.:..: ||....|..|:::.   ||:||..|           |
plant    10 LSLSLGFAQNHPLQLNLKPTSSPMSNL-QMFPWNQTLVSSSD---QQKQQFLRKIDVNSLPTTVD 70

  Fly   100 LNRELGM-DPHSEQRIKLDSVSPTHNIHAGSSRGIKQDPLSDEGADSNLGQNDCTESSKKRRG-- 161
            |..|.|: .|:|       ::|.|   .:|..|..:::..|..|...:|   |.|......||  
plant    71 LEEETGVSSPNS-------TISST---VSGKRRSTEREGTSGGGCGDDL---DITLDRSSSRGTS 122

  Fly   162 -------------RTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLMEGRIAVWFQNRRAKW 213
                         :...:..|...||..|:..:..:...:.|||.||.|...::.||||||||:.
plant   123 DEEEDYGGETCRKKLRLSKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRART 187

  Fly   214 R-KQ-----EHTKKGPGRPAHNAHPQSCSGDPIPLSELRARELAQRSKRM-KKAIDRQAKKLQDK 271
            : ||     |:.|:             |           ..:|.:.::|: |:|.:.:|.||..:
plant   188 KLKQTEVDCEYLKR-------------C-----------VEKLTEENRRLEKEAAELRALKLSPR 228

  Fly   272 GLEVDYARL----------EAEYLAA-----HQENGVDENNWL 299
                .|.::          ..|.:|.     |.:..|..:.||
plant   229 ----LYGQMSPPTTLLMCPSCERVAGPSSSNHNQRSVSLSPWL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 18/51 (35%)
HAT1NP_193476.1 HD-ZIP_N 8..98 CDD:282474 27/101 (27%)
HOX 134..188 CDD:197696 18/53 (34%)
HALZ 190..233 CDD:128634 13/70 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.