DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and uncx

DIOPT Version :9

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_005164261.1 Gene:uncx / 798510 ZFINID:ZDB-GENE-080509-1 Length:483 Species:Danio rerio


Alignment Length:375 Identity:126/375 - (33%)
Similarity:170/375 - (45%) Gaps:97/375 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GQVQHPHGSSALQLYAAA-------AAVNMQVSGWSSVLNLSMDAPNPEISPNSVTNSSSVYMIR 73
            |.|..|:..|...:|..|       |||...:.|   :||.|..|        ||.||:.:    
Zfish    20 GMVSFPYHLSHHHVYELAGHQLQSTAAVPFSIDG---LLNGSCTA--------SVVNSNPL---- 69

  Fly    74 QMALIQQARVAAAAVAMQQQQQQQRDLNRELGMDPHSEQRIKLDSVSPTHNIHAGSSRGIKQDPL 138
                                      |:...||:..::|....||..|.           |..| 
Zfish    70 --------------------------LSSGCGMNGDNQQYKLTDSGDPD-----------KDSP- 96

  Fly   139 SDEGADSNLGQNDCTESSKKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLMEGRIA 203
                            ..|:||.||||..|||.|||:.|..|||||:|||||||.:|||:|.|:.
Zfish    97 ----------------GCKRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLDLIESRVQ 145

  Fly   204 VWFQNRRAKWRKQEHTKKGPGRPAHNAHPQSCSGDPIPLSELRARELAQRSKRMKKAIDRQAKKL 268
            ||||||||||||:|:|||||||||||:||.:|||:|:...|:..||| :|.::.|:..:|:..|.
Zfish   146 VWFQNRRAKWRKKENTKKGPGRPAHNSHPTTCSGEPMDPEEIARREL-ERLEKKKRKQERRLLKS 209

  Fly   269 QDKGLEVDYARLEAEYLAAHQENGVDENNWLDD--DGYDDLHIDVVGVEPEYVTGDSLDHSFCSS 331
            |:|.|..|          .....|.|.::.|..  |....||.| :|......:.|.......:.
Zfish   210 QNKLLPGD----------LFHTPGSDSDSGLSQITDSEQSLHCD-MGRNQTQPSCDQTPQKLQNQ 263

  Fly   332 RTYQTKSTSSELDSNDMGLQGRVETPPPPQPPMQNKTLYN-SPFSIESLL 380
            |.....::.|||||:|.|.|..:.:      ..::..|.. :|||:||||
Zfish   264 RNADQDASGSELDSSDSGQQSNLCS------NSRSSALQKLNPFSVESLL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 37/51 (73%)
uncxXP_005164261.1 Homeobox 103..156 CDD:278475 37/52 (71%)
DUF3381 <154..212 CDD:288694 31/58 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004658
OrthoInspector 1 1.000 - - mtm6384
orthoMCL 1 0.900 - - OOG6_108739
Panther 1 1.100 - - O PTHR46799
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4373
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.