DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and CG34367

DIOPT Version :10

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster


Alignment Length:177 Identity:59/177 - (33%)
Similarity:77/177 - (43%) Gaps:61/177 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 NRELGMDP------HS--EQRIKLDSVSPTHNIHAGSSRGIKQDPLSDEGADSNLGQND------ 151
            |..|.:||      ||  |:.::..|:|||  :|..:.....::.|..|..|.:....|      
  Fly    78 NTILAIDPEPTEESHSQREEHVETYSLSPT--LHKAAVEPKPKNWLISEDLDVDSQPEDPKMSGL 140

  Fly   152 -------CTESS--------------------------------------KKRRGRTNFNSWQLR 171
                   |||.|                                      |:||.||||...||.
  Fly   141 PTASITECTEDSNTPKLAPDKPLLPEECVSPEPSRNREHCDPLDTSLVNTKQRRSRTNFTLDQLN 205

  Fly   172 ELERVFQGSHYPDIFMREALATKLDLMEGRIAVWFQNRRAKWRKQEH 218
            ||||:|:.:||||.||||.|:.:|.|.|.|:.|||||||||.||.|:
  Fly   206 ELERLFEETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKHEN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeodomain 159..215 CDD:459649 35/55 (64%)
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 35/55 (64%)
OAR 392..410 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.