DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and uncx4.1

DIOPT Version :9

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001018616.2 Gene:uncx4.1 / 553947 ZFINID:ZDB-GENE-050714-1 Length:470 Species:Danio rerio


Alignment Length:263 Identity:104/263 - (39%)
Similarity:141/263 - (53%) Gaps:36/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 GSSRGIKQD---PLSDEGADSNLGQNDCTESSKKRRGRTNFNSWQLRELERVFQGSHYPDIFMRE 189
            ||..|:..|   .|.| |.|.:.....|    |:||.||||..|||.|||:....|||||:||||
Zfish    73 GSGCGVNGDSQYKLGD-GGDPDKESPGC----KRRRTRTNFTGWQLEELEKASNESHYPDVFMRE 132

  Fly   190 ALATKLDLMEGRIAVWFQNRRAKWRKQEHTKKGPGRPAHNAHPQSCSGDPIPLSELRARELAQRS 254
            |||.:|||:|.|:.||||||||||||:|:|||||||||||:||.:|||:|:...|:..||| :|.
Zfish   133 ALALRLDLVESRVQVWFQNRRAKWRKKENTKKGPGRPAHNSHPTTCSGEPMDPEEIARREL-ERL 196

  Fly   255 KRMKKAIDRQAKKLQDKGLEVDYARLEAEYLAAHQENGVDENNWLDDDGYDDLHIDVVGVEPEYV 319
            ::.|:..:|:..|.|:|.|..:.....    .:..::||.::.    |.....|     ..|::.
Zfish   197 EKKKRKQERKLLKSQNKLLAGELFHTP----GSDSDSGVSQST----DSESTPH-----TGPQHS 248

  Fly   320 TGDSLDHSFCSSRT-YQTKSTSSE----LDS-NDMGLQGRVETPPPPQPPMQNKTLYN-SPFSIE 377
            .........|.... :|..||.:|    :|| .:.||       .|.....:..||.. :|||:|
Zfish   249 AHRQQTEHICEQHARHQRASTVNETAEPMDSTRNSGL-------CPANGITRASTLQKLNPFSVE 306

  Fly   378 SLL 380
            |||
Zfish   307 SLL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 36/51 (71%)
uncx4.1NP_001018616.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..102 6/23 (26%)
Homeobox 104..157 CDD:278475 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..185 20/27 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 199..289 21/109 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BD9D
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004658
OrthoInspector 1 1.000 - - mtm6384
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46799
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4373
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.