DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and barx1

DIOPT Version :9

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001020120.1 Gene:barx1 / 553644 ZFINID:ZDB-GENE-050522-28 Length:248 Species:Danio rerio


Alignment Length:250 Identity:61/250 - (24%)
Similarity:89/250 - (35%) Gaps:85/250 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 MQQQQQQQRDLNRELGMDPHSEQRIK-------------LDSVSPTHN--IHAGSSRGIKQDPLS 139
            :.|:..:.|....|..:..|.:|::.             |.|..|.||  :......||.:.|:|
Zfish    18 LDQRSHRYRSFMIEEILTDHPDQKVSSPTGDLLKFGVHALLSARPYHNHLVLKADQTGILKFPVS 82

  Fly   140 ----------------------------------------DEGADSNLGQNDCTESSKKRRGRTN 164
                                                    |.|||:      .:::.|.||.||.
Zfish    83 PLSCSLGAPLSSALLSGAAGLQVGSSSHHLPLDLHLRGKLDPGADA------VSKTKKGRRSRTV 141

  Fly   165 FNSWQLRELERVFQGSHY---PDIFMREALATKLDLMEGRIAVWFQNRRAKWRK-------QEHT 219
            |...||..||:.|:...|   ||   |..||..|.|.:.::..|:||||.||:|       .|..
Zfish   142 FTELQLMGLEKRFEKQKYLSTPD---RIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESP 203

  Fly   220 KKGPGRPAHNAHPQSCSGDPIPLSELRARELAQRSKRMKKAIDRQAKKLQDKGLE 274
            .|..|||..|:         ||.||..:.:  :|::...:..|..|..|.|...|
Zfish   204 TKPKGRPKKNS---------IPTSEQLSEQ--ERTREADRLSDGGASSLSDANQE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 22/54 (41%)
barx1NP_001020120.1 Homeobox 138..191 CDD:278475 22/55 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..248 15/61 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.