DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and crx

DIOPT Version :10

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001016021.1 Gene:crx / 548775 XenbaseID:XB-GENE-478452 Length:290 Species:Xenopus tropicalis


Alignment Length:74 Identity:37/74 - (50%)
Similarity:48/74 - (64%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 TESSKKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLMEGRIAVWFQNRRAKWRKQE 217
            |...|:||.||.|...||..||.:|..:.||||||||.:|.|::|.|.|:.|||:|||||.|:|:
 Frog    33 TTPRKQRRERTTFTRAQLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQ 97

  Fly   218 HTKKGPGRP 226
            ....|..:|
 Frog    98 QQSTGQAKP 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeodomain 159..215 CDD:459649 31/55 (56%)
crxNP_001016021.1 Homeodomain 39..94 CDD:459649 31/54 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..144 4/14 (29%)
TF_Otx 152..236 CDD:427350
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.