DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and Ptx1

DIOPT Version :9

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster


Alignment Length:227 Identity:69/227 - (30%)
Similarity:106/227 - (46%) Gaps:62/227 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GQVQHPHGS------------SALQLYAAAAAVNMQVSGWSSVLNLSMDAPNPEISPNSVTNSSS 68
            |..||||.:            ..|:::|.........|..::|.| |:|:.:..   |..|:|:|
  Fly   153 GYSQHPHHTVVPPHTPKHEPLEKLRIWAETGDFRDSHSSMTAVAN-SLDSTHLN---NFQTSSTS 213

  Fly    69 VYMIRQMALIQQARVAAAAVAMQQQQQQQRDLNRELGMDPHSEQRIKLDSVSPTHNIHAGSSRGI 133
                                ::..:.:.::|.||.:     :|..||      |.||   ||.| 
  Fly   214 --------------------SISNRSRDRKDGNRSV-----NETTIK------TENI---SSSG- 243

  Fly   134 KQDPLSDEGADSNLGQNDCTESSKKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLM 198
            ..:|::..|.:.   :|| .::.::||.||:|.|.||:|||..|..:.|||:..||.:|...:|.
  Fly   244 HDEPMTTSGEEP---KND-KKNKRQRRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLT 304

  Fly   199 EGRIAVWFQNRRAKWRKQEHTKKGPGRPAHNA 230
            |.|:.|||:||||||||:|       |.|.||
  Fly   305 EARVRVWFKNRRAKWRKRE-------RNAMNA 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 27/51 (53%)
Ptx1NP_001138130.2 Homeobox 268..320 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.