Sequence 1: | NP_523389.3 | Gene: | OdsH / 32758 | FlyBaseID: | FBgn0026058 | Length: | 382 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002661267.2 | Gene: | si:dkey-43p13.5 / 407678 | ZFINID: | ZDB-GENE-131121-510 | Length: | 315 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 66/200 - (33%) |
---|---|---|---|
Similarity: | 85/200 - (42%) | Gaps: | 82/200 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 137 PLSDEGADSNLGQNDCTESSKKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLMEGR 201
Fly 202 IAVWFQNRRAKWRKQ------------------EHTKKGPGRP-AHN----------------AH 231
Fly 232 P-----------------------------QSCSGDPIPLSELRAR---------ELAQRSKRMK 258
Fly 259 KAIDR 263 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
OdsH | NP_523389.3 | Homeobox | 162..214 | CDD:278475 | 37/51 (73%) |
si:dkey-43p13.5 | XP_002661267.2 | Homeobox | 145..197 | CDD:278475 | 37/51 (73%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0004658 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |