DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and si:dkey-43p13.5

DIOPT Version :9

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_002661267.2 Gene:si:dkey-43p13.5 / 407678 ZFINID:ZDB-GENE-131121-510 Length:315 Species:Danio rerio


Alignment Length:200 Identity:66/200 - (33%)
Similarity:85/200 - (42%) Gaps:82/200 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 PLSDEGADSNLGQNDCTESSKKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLMEGR 201
            |.|...|| |:   |.....|:||.|.|::||||.|||:.||.:||||||||||||.:|||:|.|
Zfish   124 PSSGHPAD-NI---DEPRPVKQRRARANYSSWQLEELEKTFQSTHYPDIFMREALALRLDLIEAR 184

  Fly   202 IAVWFQNRRAKWRKQ------------------EHTKKGPGRP-AHN----------------AH 231
            :.|||||||||.|:|                  .|.:.....| .||                ||
Zfish   185 VQVWFQNRRAKMRRQLKLQIQTGEQCSQRDTDTRHPESSISNPELHNNSPSPCWDRNQDRTNPAH 249

  Fly   232 P-----------------------------QSCSGDPIPLSELRAR---------ELAQRSKRMK 258
            |                             :|||     :::|||:         ....|.::||
Zfish   250 PKPSPSAIQSPVTDLLQDQQDPEAPGPEDLRSCS-----IAKLRAKARDYEAEIHSTVARERKMK 309

  Fly   259 KAIDR 263
            :..||
Zfish   310 RVSDR 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 37/51 (73%)
si:dkey-43p13.5XP_002661267.2 Homeobox 145..197 CDD:278475 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004658
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.