DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and UNCX

DIOPT Version :9

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001073930.1 Gene:UNCX / 340260 HGNCID:33194 Length:531 Species:Homo sapiens


Alignment Length:373 Identity:114/373 - (30%)
Similarity:150/373 - (40%) Gaps:156/373 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VQHPH---GSS----------------------ALQLYAAAAAVNMQVSGWSSVLNLSMDAPNPE 57
            ::|||   |.|                      .||..||||:|...:.|               
Human     7 LEHPHAQFGGSLGGVVGFPYPLGHHHVYELAGHQLQSAAAAASVPFSIDG--------------- 56

  Fly    58 ISPNSVTNSSSVYMIRQMALIQQARVAAAAVAMQQQQQQQRDLNRELGMDPHSEQRIKLDSVSPT 122
                               |:..:..|||:|                              |:||
Human    57 -------------------LLGGSCAAAASV------------------------------VNPT 72

  Fly   123 HNIHAGSSRGIKQDP--LSDEGADSNLGQNDCTESSKKRRGRTNFNSWQLRELERVFQGSHYPDI 185
            ..:.|....|....|  |||.| |.:.....|    |:||.||||..|||.|||:.|..|||||:
Human    73 PLLPAACGVGGDGQPFKLSDSG-DPDKESPGC----KRRRTRTNFTGWQLEELEKAFNESHYPDV 132

  Fly   186 FMREALATKLDLMEGRIAVWFQNRRAKWRKQEHTKKGPGRPAHNAHPQSCSGDPIPLSELRAREL 250
            |||||||.:|||:|.|:.||||||||||||:|:|||||||||||:||.:|||:|:...|:..:||
Human   133 FMREALALRLDLVESRVQVWFQNRRAKWRKKENTKKGPGRPAHNSHPTTCSGEPMDPEEIARKEL 197

  Fly   251 AQRSKRMKKAIDRQAKKLQDKGLEVDYARLEAEYLAAHQENGVDENNWLDDDGYDDLHIDVVGVE 315
            .:..|:.:|   .:.|.|:.:|..:            |...|:            .||       
Human   198 EKMEKKKRK---HEKKLLKSQGRHL------------HSPGGL------------SLH------- 228

  Fly   316 PEYVTGDSLDHSFCSSRTYQTKSTSSELDSNDMGLQGRVETPPPPQPP 363
                                 .:.||:.||...||     :|.||:||
Human   229 ---------------------SAPSSDSDSGGGGL-----SPEPPEPP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 37/51 (73%)
UNCXNP_001073930.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..107 8/24 (33%)
Homeobox 108..161 CDD:306543 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..312 43/150 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..344
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BD9D
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004658
OrthoInspector 1 1.000 - - otm41083
orthoMCL 1 0.900 - - OOG6_108739
Panther 1 1.100 - - O PTHR46799
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5708
SonicParanoid 1 1.000 - - X4373
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.