DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and unc-4

DIOPT Version :9

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster


Alignment Length:341 Identity:145/341 - (42%)
Similarity:191/341 - (56%) Gaps:66/341 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HGSSALQLYAAAAAV---NMQVSGWSSVLNLSM----------------DAPNPEISPNS----- 62
            |.::|||||||||.:   .::|..|...|...:                ||.:....|||     
  Fly    92 HPTAALQLYAAAAQLAPNGVRVPPWGPFLQFGVPGVFGPNGPFLGRPRFDAASAGGHPNSAAAAA 156

  Fly    63 ------VTNSSSVY---------MIRQMALIQQARVAAAAVAMQQQQQQQRDLNRELGMDPHSEQ 112
                  ..|:|:.:         .:|.::..|...|||.|..:...|.:....||:         
  Fly   157 AATQMAAVNASNAFANLTGLSAAALRNVSAAQTTAVAAVASTVATIQHRLMIGNRQ--------- 212

  Fly   113 RIKLDSVSPTHNIHAGSSRGIKQDPLSDEGADSNLGQNDCTESSKKRRGRTNFNSWQLRELERVF 177
                 |:.|......||         :::|.....|.:| :.::|:||.|||||||||.||||.|
  Fly   213 -----SLPPAGPPSEGS---------NEDGGFPGDGDDD-SSAAKRRRSRTNFNSWQLEELERAF 262

  Fly   178 QGSHYPDIFMREALATKLDLMEGRIAVWFQNRRAKWRKQEHTKKGPGRPAHNAHPQSCSGDPIPL 242
            ..|||||||||||||.:|||.|.|:||||||||||.||:||||||||||||||.||:|||:|||.
  Fly   263 SASHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVRKREHTKKGPGRPAHNAQPQTCSGEPIPP 327

  Fly   243 SELRARELAQRSKRMKKAIDRQAKKLQDKGLEVDYARLEAEYLAAHQENGVDENNWLDDDGYDDL 307
            :||:|:|.|:|.|::.|||||||:|||.||:.||...|:|||::.|:.||...::.|:|||   :
  Fly   328 NELKAKERARRRKKLAKAIDRQARKLQAKGITVDLEALKAEYISQHKANGTFSDSDLEDDG---I 389

  Fly   308 HIDVVGVEPEYVTGDS 323
            .|||||.......|||
  Fly   390 QIDVVGGTDSDDEGDS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 42/51 (82%)
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 42/52 (81%)
NK <327..>368 CDD:302627 22/40 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004658
OrthoInspector 1 1.000 - - mtm6384
orthoMCL 1 0.900 - - OOG6_108739
Panther 1 1.100 - - P PTHR46799
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4373
87.960

Return to query results.
Submit another query.