DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and otx1

DIOPT Version :10

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_571325.2 Gene:otx1 / 30500 ZFINID:ZDB-GENE-980526-400 Length:323 Species:Danio rerio


Alignment Length:125 Identity:47/125 - (37%)
Similarity:62/125 - (49%) Gaps:16/125 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 IKQDPLSDEGADSNLGQNDCTESS--------KKRRGRTNFNSWQLRELERVFQGSHYPDIFMRE 189
            :||.|.:..|...:....|....|        |:||.||.|...||..||.:|..:.||||||||
Zfish     5 LKQPPYAMNGLGLSGAAMDLLHPSVGYPATPRKQRRERTTFTRSQLDILEALFAKTRYPDIFMRE 69

  Fly   190 ALATKLDLMEGRIAVWFQNRRAKWRKQEH----TKKGPGR----PAHNAHPQSCSGDPIP 241
            .:|.|::|.|.|:.|||:|||||.|:|:.    ||..|.:    |...:.....||...|
Zfish    70 EVALKINLPESRVQVWFKNRRAKCRQQQQSGSSTKTRPAKKKSSPTRESTGSESSGQFTP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeodomain 159..215 CDD:459649 31/55 (56%)
otx1NP_571325.2 Homeodomain 39..95 CDD:459649 31/55 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..155 11/39 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..204
TF_Otx 172..258 CDD:427350
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..277
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.