DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and Uncx

DIOPT Version :9

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_058875.2 Gene:Uncx / 29375 RGDID:69361 Length:530 Species:Rattus norvegicus


Alignment Length:362 Identity:115/362 - (31%)
Similarity:149/362 - (41%) Gaps:152/362 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QLQQAAAARGQVQHPHGSSALQLYAAAAAVNMQVSGWSSVLNLSMDAPNPEISPNSVTNSSSVYM 71
            |||.||||                ||||:|...:.|                             
  Rat    40 QLQSAAAA----------------AAAASVPFSIDG----------------------------- 59

  Fly    72 IRQMALIQQARVAAAAVAMQQQQQQQRDLNRELGMDPHSEQRIKLDSVSPTHNIH-----AGSSR 131
                 |:..:..||||                             ..|:||..:.     ||.|:
  Rat    60 -----LLSGSCAAAAA-----------------------------SVVNPTPLLPAACGVAGESQ 90

  Fly   132 GIKQDPLSDEGADSNLGQNDCTESSKKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLD 196
            ..|   |:|.| |.:.....|    |:||.||||..|||.|||:.|..|||||:|||||||.:||
  Rat    91 PFK---LADSG-DPDKESPGC----KRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLD 147

  Fly   197 LMEGRIAVWFQNRRAKWRKQEHTKKGPGRPAHNAHPQSCSGDPIPLSELRARELAQRSKRMKKAI 261
            |:|.|:.||||||||||||:|:|||||||||||:||.:|||:|:...|:..:||.:..|:.:|  
  Rat   148 LVESRVQVWFQNRRAKWRKKENTKKGPGRPAHNSHPTTCSGEPMDPEEIARKELEKMEKKKRK-- 210

  Fly   262 DRQAKKLQDKGLEVDYARLEAEYLAAHQENGVDENNWLDDDGYDDLHIDVVGVEPEYVTGDSLDH 326
              ..|||           |:::....|...|:            .||                  
  Rat   211 --HEKKL-----------LKSQSRHLHSPGGL------------SLH------------------ 232

  Fly   327 SFCSSRTYQTKSTSSELDSNDMGLQGRVETPPPPQPP 363
                      .:.||:.||...||     :|.||:||
  Rat   233 ----------SAPSSDSDSGGGGL-----SPEPPEPP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 37/51 (73%)
UncxNP_058875.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..111 7/28 (25%)
Homeobox 112..166 CDD:395001 38/53 (72%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..362 44/150 (29%)
PHA03247 <289..524 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BD9D
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I3988
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004658
OrthoInspector 1 1.000 - - otm45223
orthoMCL 1 0.900 - - OOG6_108739
Panther 1 1.100 - - O PTHR46799
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4373
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.