DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and GSC2

DIOPT Version :10

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_005306.1 Gene:GSC2 / 2928 HGNCID:4613 Length:205 Species:Homo sapiens


Alignment Length:77 Identity:34/77 - (44%)
Similarity:45/77 - (58%) Gaps:10/77 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 KKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLMEGRIAVWFQNRRAKWRKQEH--- 218
            :.||.||.|:..||:.||.:|..:.|||:..||.||.::.|.|.|:.|||:|||||||.|:.   
Human   125 RTRRHRTIFSEEQLQALEALFVQNQYPDVSTRERLAGRIRLREERVEVWFKNRRAKWRHQKRASA 189

  Fly   219 -------TKKGP 223
                   .||.|
Human   190 SARLLPGVKKSP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeodomain 159..215 CDD:459649 29/55 (53%)
GSC2NP_005306.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..58
Homeodomain 127..183 CDD:459649 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..205 3/17 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.