DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and Shox2

DIOPT Version :10

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_037160.2 Gene:Shox2 / 25546 RGDID:3674 Length:331 Species:Rattus norvegicus


Alignment Length:115 Identity:52/115 - (45%)
Similarity:66/115 - (57%) Gaps:5/115 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GMDPHSEQRIKLDSVSPTHNIHAGSSRGIKQDP-LSDEGADSNLGQNDCTESSKKRRGRTNFNSW 168
            |..|..|    ||..:...:...||.|..:..| |.|...|:...:::.....|:||.||||...
  Rat    90 GRSPVRE----LDMGAAERSREPGSPRLTEVSPELKDRKEDAKGMEDEGQTKIKQRRSRTNFTLE 150

  Fly   169 QLRELERVFQGSHYPDIFMREALATKLDLMEGRIAVWFQNRRAKWRKQEH 218
            ||.||||:|..:||||.||||.|:.:|.|.|.|:.|||||||||.||||:
  Rat   151 QLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQEN 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeodomain 159..215 CDD:459649 35/55 (64%)
Shox2NP_037160.2 Homeodomain 141..197 CDD:459649 35/55 (64%)
OAR 311..327 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.