DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and Drgx

DIOPT Version :10

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_665710.2 Gene:Drgx / 252880 RGDID:628616 Length:263 Species:Rattus norvegicus


Alignment Length:108 Identity:45/108 - (41%)
Similarity:62/108 - (57%) Gaps:3/108 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 KKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLMEGRIAVWFQNRRAKWRKQEHTKK 221
            |:||.||.|...||..||.||..:||||:|.||.||.|::|.|.|:.||||||||||||   |::
  Rat    32 KQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQVWFQNRRAKWRK---TER 93

  Fly   222 GPGRPAHNAHPQSCSGDPIPLSELRARELAQRSKRMKKAIDRQ 264
            |.......|........|.|:..:.:.....:::..|:|::.|
  Rat    94 GASDQEPGAKEPMAEVTPPPVRNINSPPPGDQARGKKEALEAQ 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeodomain 159..215 CDD:459649 34/55 (62%)
DrgxNP_665710.2 Homeodomain 34..90 CDD:459649 34/55 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..135 10/49 (20%)
OAR 201..218 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 204..217
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..263
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.