DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and Uncx

DIOPT Version :9

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_038730.1 Gene:Uncx / 22255 MGIID:108013 Length:530 Species:Mus musculus


Alignment Length:362 Identity:115/362 - (31%)
Similarity:149/362 - (41%) Gaps:152/362 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QLQQAAAARGQVQHPHGSSALQLYAAAAAVNMQVSGWSSVLNLSMDAPNPEISPNSVTNSSSVYM 71
            |||.||||                ||||:|...:.|                             
Mouse    40 QLQSAAAA----------------AAAASVPFSIDG----------------------------- 59

  Fly    72 IRQMALIQQARVAAAAVAMQQQQQQQRDLNRELGMDPHSEQRIKLDSVSPTHNIH-----AGSSR 131
                 |:..:..||||                             ..|:||..:.     ||.|:
Mouse    60 -----LLSGSCAAAAA-----------------------------SVVNPTPLLPAACGVAGESQ 90

  Fly   132 GIKQDPLSDEGADSNLGQNDCTESSKKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLD 196
            ..|   |:|.| |.:.....|    |:||.||||..|||.|||:.|..|||||:|||||||.:||
Mouse    91 PFK---LADSG-DPDKESPGC----KRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLD 147

  Fly   197 LMEGRIAVWFQNRRAKWRKQEHTKKGPGRPAHNAHPQSCSGDPIPLSELRARELAQRSKRMKKAI 261
            |:|.|:.||||||||||||:|:|||||||||||:||.:|||:|:...|:..:||.:..|:.:|  
Mouse   148 LVESRVQVWFQNRRAKWRKKENTKKGPGRPAHNSHPTTCSGEPMDPEEIARKELEKMEKKKRK-- 210

  Fly   262 DRQAKKLQDKGLEVDYARLEAEYLAAHQENGVDENNWLDDDGYDDLHIDVVGVEPEYVTGDSLDH 326
              ..|||           |:::....|...|:            .||                  
Mouse   211 --HEKKL-----------LKSQSRHLHSPGGL------------SLH------------------ 232

  Fly   327 SFCSSRTYQTKSTSSELDSNDMGLQGRVETPPPPQPP 363
                      .:.||:.||...||     :|.||:||
Mouse   233 ----------SAPSSDSDSGGGGL-----SPEPPEPP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 37/51 (73%)
UncxNP_038730.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..111 7/28 (25%)
Homeobox 112..165 CDD:278475 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..360 44/150 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004658
OrthoInspector 1 1.000 - - otm43154
orthoMCL 1 0.900 - - OOG6_108739
Panther 1 1.100 - - O PTHR46799
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5708
SonicParanoid 1 1.000 - - X4373
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.