DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and Gsc2

DIOPT Version :10

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_083745.2 Gene:Gsc2 / 195333 MGIID:892006 Length:201 Species:Mus musculus


Alignment Length:103 Identity:39/103 - (37%)
Similarity:54/103 - (52%) Gaps:17/103 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 GADSNLGQNDCTESSKKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLMEGRIAVWF 206
            |:.:..|.:......:.||.||.|:..||:.||.:|..:.|||:..||.||.::.|.|.|:.|||
Mouse   107 GSPALTGTSGPGPQRRTRRHRTIFSEEQLQALEALFVQNQYPDVGTRERLAVRIRLREERVEVWF 171

  Fly   207 QNRRAKWRKQEH---------TKKGPGRPAHNAHPQSC 235
            :|||||||.|:.         |||.|        .:||
Mouse   172 KNRRAKWRHQKRASSSRLLPGTKKTP--------KESC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeodomain 159..215 CDD:459649 29/55 (53%)
Gsc2NP_083745.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..124 2/16 (13%)
Homeodomain 124..180 CDD:459649 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..201 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.