DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and Prrx1

DIOPT Version :10

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_035257.1 Gene:Prrx1 / 18933 MGIID:97712 Length:245 Species:Mus musculus


Alignment Length:94 Identity:45/94 - (47%)
Similarity:61/94 - (64%) Gaps:5/94 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 SSRGIKQDPLSDEGADSNLGQNDCTESS-----KKRRGRTNFNSWQLRELERVFQGSHYPDIFMR 188
            :.|.:.:.|....|:|:....||...|.     |:||.||.|||.||:.|||||:.:||||.|:|
Mouse    60 AGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVR 124

  Fly   189 EALATKLDLMEGRIAVWFQNRRAKWRKQE 217
            |.||.:::|.|.|:.|||||||||:|:.|
Mouse   125 EDLARRVNLTEARVQVWFQNRRAKFRRNE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeodomain 159..215 CDD:459649 35/55 (64%)
Prrx1NP_035257.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..103 13/42 (31%)
Homeodomain 99..151 CDD:459649 32/51 (63%)
OAR 219..235 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 222..235
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.