DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and Otp

DIOPT Version :10

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_035151.1 Gene:Otp / 18420 MGIID:99835 Length:325 Species:Mus musculus


Alignment Length:124 Identity:50/124 - (40%)
Similarity:64/124 - (51%) Gaps:20/124 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 QDPLSDEGAD-----SNLGQNDCTESSKKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATK 194
            :||....|..     |..||..  ...|::|.||.|...||.||||.|..:|||||||||.||.:
Mouse    78 KDPDKQPGPQGGPNPSQAGQQQ--GQQKQKRHRTRFTPAQLNELERSFAKTHYPDIFMREELALR 140

  Fly   195 LDLMEGRIAVWFQNRRAKWRKQEHTK---KGPGR----------PAHNAHPQSCSGDPI 240
            :.|.|.|:.||||||||||:|::.|.   :.||.          |:..|...:..||.:
Mouse   141 IGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTLLPTPGLPQFPSAAAAAAAAMGDSL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeodomain 159..215 CDD:459649 35/55 (64%)
OtpNP_035151.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..112 10/35 (29%)
Homeodomain 106..156 CDD:459649 30/49 (61%)
OAR 303..320 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.