DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and dsc-1

DIOPT Version :9

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_510497.1 Gene:dsc-1 / 181599 WormBaseID:WBGene00001096 Length:310 Species:Caenorhabditis elegans


Alignment Length:232 Identity:66/232 - (28%)
Similarity:99/232 - (42%) Gaps:31/232 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DQLIQQLQQAAAARGQVQHPHGSSALQLYAAAAAVNMQVSGWSSVLNLSMDAPNPEISPNSVTNS 66
            |..:..:||.|    |..||..:...||          ...||...:...|.|     |.|..::
 Worm    31 DFSVPPVQQGA----QQFHPPRNLGPQL----------ARRWSCGDSQHADEP-----PASYYHN 76

  Fly    67 SSVYMIRQMALIQQ---------ARVAAAAVAMQQQQQQQRDLNRELG-MDPHS-EQRIKLDSVS 120
            ..|.:.....:..|         ..|:..:.|.:..|..|......:| .|||. ......:|:.
 Worm    77 LGVALHNHFQMSNQHYLSDFDCPTTVSPISSAHETGQLPQLSPYDHIGNQDPHMFSPHAYGNSMI 141

  Fly   121 PTHNIHAGSSRGIKQDPLSDEGADSNLGQNDCTES-SKKRRGRTNFNSWQLRELERVFQGSHYPD 184
            |.::....:||.|....:.:...:.:|..:|..:| ..:||.||||...|...||..|:.|||||
 Worm   142 PDNSYFENASRSISAPNVGNSTLNPSLMSSDNAQSCGGRRRFRTNFTELQSTFLEDSFKESHYPD 206

  Fly   185 IFMREALATKLDLMEGRIAVWFQNRRAKWRKQEHTKK 221
            ...::.:|..|.:.|.||.|||||||||||::||.::
 Worm   207 HKAKKYMADFLKIPEDRITVWFQNRRAKWRRKEHRQR 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 27/51 (53%)
dsc-1NP_510497.1 Homeobox 184..236 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.