DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and unc-4

DIOPT Version :9

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_496138.1 Gene:unc-4 / 174544 WormBaseID:WBGene00006744 Length:252 Species:Caenorhabditis elegans


Alignment Length:107 Identity:55/107 - (51%)
Similarity:68/107 - (63%) Gaps:14/107 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 GSSRGIKQDPLSDEGADSNL-----------GQNDCTES-SKKRRGRTNFNSWQLRELERVFQGS 180
            |.|...::...|.:  |.||           ..||..|| :|:||.||||:.|||.|||..|:.|
 Worm    48 GKSTSSREQSTSPD--DDNLLMNEDDGIALEDDNDTGESAAKRRRTRTNFSGWQLEELESAFEAS 110

  Fly   181 HYPDIFMREALATKLDLMEGRIAVWFQNRRAKWRKQEHTKKG 222
            ||||:|||||||.:|||:|.|:.||||||||||||:|..:.|
 Worm   111 HYPDVFMREALAMRLDLLESRVQVWFQNRRAKWRKREQNRNG 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 37/51 (73%)
unc-4NP_496138.1 COG5576 <79..186 CDD:227863 49/74 (66%)
Homeobox 91..144 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BD9D
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004658
OrthoInspector 1 1.000 - - otm14214
orthoMCL 1 0.900 - - OOG6_108739
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.