DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and CRX

DIOPT Version :10

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_000545.1 Gene:CRX / 1406 HGNCID:2383 Length:299 Species:Homo sapiens


Alignment Length:104 Identity:43/104 - (41%)
Similarity:60/104 - (57%) Gaps:17/104 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 KKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLMEGRIAVWFQNRRAKWRKQEHTKK 221
            |:||.||.|...||.|||.:|..:.|||::.||.:|.|::|.|.|:.|||:|||||.|:|...:|
Human    38 KQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCRQQRQQQK 102

  Fly   222 ----GPG-----RPAH-----NAHPQS--CSGDPIPLSE 244
                .||     |||.     :..|.:  |. ||:.:|:
Human   103 QQQQPPGGQAKARPAKRKAGTSPRPSTDVCP-DPLGISD 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeodomain 159..215 CDD:459649 29/55 (53%)
CRXNP_000545.1 Homeodomain 40..93 CDD:459649 27/52 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..155 14/49 (29%)
TF_Otx 164..249 CDD:427350
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.