DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and Vsx2

DIOPT Version :9

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001288356.1 Gene:Vsx2 / 12677 MGIID:88401 Length:380 Species:Mus musculus


Alignment Length:297 Identity:85/297 - (28%)
Similarity:118/297 - (39%) Gaps:101/297 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 QQQRDLNRELGMDPHSEQRIKLDSVSPTHNIHA-----------------GSSRGIKQDP----- 137
            |:...||:|   .|.|..|..||.::|.|.:.|                 |...|....|     
Mouse    35 QEILGLNKE---PPSSHPRAALDGLAPGHLLAARSVLSPAGVGSMGLLGPGGLPGFYTQPTFLEV 96

  Fly   138 LSD-----------------------------EGADSNLGQN--DCTESSKKRRGRTNFNSWQLR 171
            |||                             ..:|..:.::  :.|:..||||.||.|.|:||.
Mouse    97 LSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLE 161

  Fly   172 ELERVFQGSHYPDIFMREALATKLDLMEGRIAVWFQNRRAKWRKQE------------------- 217
            |||:.|..:||||::.||.||.|.:|.|.||.||||||||||||:|                   
Mouse   162 ELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMV 226

  Fly   218 -HTKKGPG---RPAHNAHPQSCS-------GDPIPLSE-----------LRARELAQRSKRMKKA 260
             |:...|.   :.|.:....||:       |.|...|:           .::.|.|..|.| |..
Mouse   227 RHSIPLPESILKSAKDGIMDSCAPWLLVQDGFPRRFSKPEYQQFFLGMHKKSLEAAAESGR-KPE 290

  Fly   261 IDRQAKKLQDKGLEVDYARLEAEYLAAHQENGVDENN 297
            ::|||....|| :|.:....||:  ||..:..:.||:
Mouse   291 VERQALPKLDK-MEQEERAPEAQ--AAISQEELRENS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 32/51 (63%)
Vsx2NP_001288356.1 Homeobox 153..204 CDD:278475 31/50 (62%)
OAR 319..336 CDD:281777 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.