DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and Vsx1

DIOPT Version :9

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_473409.1 Gene:Vsx1 / 114889 MGIID:1890816 Length:363 Species:Mus musculus


Alignment Length:301 Identity:90/301 - (29%)
Similarity:128/301 - (42%) Gaps:55/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ARVAAAAVAMQQQQQQQRDLN--RELGMDPHSEQRIKLDSVSPTHNIHAGSSRGIKQDPLSDEGA 143
            |:..:||.|.:.:.....||.  ...|.:|...|       .|.|...|..|:...:...:.:|.
Mouse    94 AQPPSAAAAARARCLLLADLRLLPSAGPEPAVAQ-------GPVHPPPALGSQQRSESVSTSDGD 151

  Fly   144 DSNLGQNDCTES-----SKKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLMEGRIA 203
            ..:..:||...|     .||||.||.|.:.||.|||:.|..:||||::.||.||.|.:|.|.||.
Mouse   152 SPSEEKNDPKMSLILGKRKKRRHRTVFTAHQLEELEKAFGEAHYPDVYAREMLAAKTELPEDRIQ 216

  Fly   204 VWFQNRRAKWRKQEHTKKGPGRPA----HNAHPQSCSGDPIPLSELRARELAQRS------KRMK 258
            ||||||||||||:|....|....|    :.|..:.|.  |:|.|.|.:.:..|.|      ...|
Mouse   217 VWFQNRRAKWRKREKRWGGSSVMAEYGLYGAMVRHCI--PLPDSVLNSADSLQGSCAPWLLGMHK 279

  Fly   259 KAIDRQAKKLQDK--GL-EVDYARLEAEYLAAHQENGVDENNWLDDDGYDDLHIDVVGVEPEYVT 320
            |:...:..:.:||  || |.|:.:..|.......|.|.||.....::..:|:.||:         
Mouse   280 KSTGMRKPESEDKLAGLWEFDHLKKGANKDEDGPERGPDETTQNPENSLEDVAIDL--------- 335

  Fly   321 GDSLDHSFCSSRTYQTKSTSSELDSNDMGLQGRVETPPPPQ 361
                             |:||..::..|......:.|.|||
Mouse   336 -----------------SSSSRQETKKMPPGSSTQLPQPPQ 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 31/51 (61%)
Vsx1NP_473409.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Octapeptide motif 31..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..166 10/50 (20%)
Nuclear localization signal. /evidence=ECO:0000255 168..173 2/4 (50%)
Homeobox 174..227 CDD:278475 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..363 17/86 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.