DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OdsH and DUX4

DIOPT Version :10

Sequence 1:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001280727.1 Gene:DUX4 / 100288687 HGNCID:50800 Length:424 Species:Homo sapiens


Alignment Length:88 Identity:34/88 - (38%)
Similarity:41/88 - (46%) Gaps:12/88 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 RRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLMEGRIAVWFQNRRAKWRKQEHTKKGP 223
            ||.||.....|...|.|.|:...:|.|..||.||.:..|.|.||.:|||||||:     |..:|.
Human    95 RRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRAR-----HPGQGG 154

  Fly   224 GRPAH-----NAHPQSCSGDPIP 241
            ..||.     :|.|.  .|.|.|
Human   155 RAPAQAGGLCSAAPG--GGHPAP 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdsHNP_523389.3 Homeodomain 159..215 CDD:459649 25/55 (45%)
DUX4NP_001280727.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
homeodomain 25..78 CDD:238039
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..102 4/6 (67%)
Homeodomain 95..149 CDD:459649 25/58 (43%)
PRK07764 <141..319 CDD:236090 16/42 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..362
Required for interaction with EP300 and CREBBP, and for transcriptional activation of target genes. /evidence=ECO:0000269|PubMed:26951377 327..424
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 388..414
Important for transcriptional activation of target genes. /evidence=ECO:0000269|PubMed:29618456 405..424
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.