DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-4 and alx3

DIOPT Version :9

Sequence 1:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:XP_005167168.1 Gene:alx3 / 566955 ZFINID:ZDB-GENE-120221-3 Length:364 Species:Danio rerio


Alignment Length:433 Identity:104/433 - (24%)
Similarity:143/433 - (33%) Gaps:185/433 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 FLGRPRFDAASAGGHPNSAAAAAAATQMAAVNASNAFANLTGLSAAALRNVSAAQTTAVAAVAST 198
            |:||     .:.||..:.....::.|..|:          .|.....|.|::..|..::....|:
Zfish    52 FMGR-----YADGGSADFTHGVSSTTPRAS----------PGKHTKYLENINQDQKPSITEKNSS 101

  Fly   199 VATIQHRLMIGNRQSLPPAGPPS----------EGSNEDGGFPGDGDDD----SSAAKRRRSRTN 249
            .  .:.....|::....|.|.|:          |.||   |..||...|    |...|:||:||.
Zfish   102 F--YETNSDAGDKTLSKPLGYPALDSECCGKLKEASN---GLTGDSIADSIDLSGKNKKRRNRTT 161

  Fly   250 FNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVRKREHTKKGPGRPAHN 314
            |:::||||||:.|..:||||::.||.||:|.:|.|:||.|||||||||.||||            
Zfish   162 FSTFQLEELEKVFQKTHYPDVYAREQLALRTELTEARVQVWFQNRRAKWRKRE------------ 214

  Fly   315 AQPQTCSGEPIPPNELKAKERARRRKKLAKAIDRQARKLQAKGITVDLEALKAEYISQHKANGTF 379
                                   |..|:.:..:..|       .|.|:..|..            
Zfish   215 -----------------------RYGKMQEVRNHFA-------ATYDISLLPR------------ 237

  Fly   380 SDSDLEDDGIQIDVVGGTDSDDEGDSDAVSPVRLGGGGGGGGGTGGGGGGGASSSLHCGLDGDGD 444
                               ||.....:::.|          .|.|..|.|||||:  |.|     
Zfish   238 -------------------SDTYQMQNSLWP----------SGAGATGAGGASSA--CVL----- 266

  Fly   445 SSRAGSFIGGGGSLGSPSSVAPPSMLSNGAVQFGKLEPMDGNESEERDRERDSPKPLLFPAKAFH 509
                       |:...|||...|                             .|.|         
Zfish   267 -----------GTENMPSSCMSP-----------------------------YPHP--------- 282

  Fly   510 QLNLQSSQQHHGLVVG-QGQGSGSGHGHGHQHNHHQHHLHHGS 551
                      ||.:.| .|..:..|| |.|.|:||.|..||.|
Zfish   283 ----------HGNLPGLMGMSASPGH-HHHHHHHHHHPSHHPS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 32/52 (62%)
NK <327..>368 CDD:302627 6/40 (15%)
alx3XP_005167168.1 Homeobox 159..211 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.