DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-4 and alx1

DIOPT Version :9

Sequence 1:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001038539.1 Gene:alx1 / 565176 ZFINID:ZDB-GENE-050419-191 Length:320 Species:Danio rerio


Alignment Length:125 Identity:56/125 - (44%)
Similarity:72/125 - (57%) Gaps:10/125 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 RQSLPPAGPPSEGSNEDGGFPGDGDDDSSAAKRRRSRTNFNSWQLEELERAFSASHYPDIFMREA 275
            |.|...:||.....:|.|   ...|.:.|::|:||.||.|.|.||||||:.|..:||||:::||.
Zfish    91 RVSPATSGPDKTDLDELG---EKCDSNVSSSKKRRHRTTFTSAQLEELEKVFQKTHYPDVYVREQ 152

  Fly   276 LAMRLDLKESRVAVWFQNRRAKVRKREHTKKGPGRPAHNAQ-------PQTCSGEPIPPN 328
            ||||.:|.|:||.|||||||||.||||...:.....:|.|.       |:|.|...|..|
Zfish   153 LAMRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDISMLPRTDSYSQISNN 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 34/52 (65%)
NK <327..>368 CDD:302627 1/2 (50%)
alx1NP_001038539.1 Homeobox 123..176 CDD:278475 34/52 (65%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 180..320 7/33 (21%)
OAR 296..313 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 300..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.