powered by:
Protein Alignment unc-4 and PRRX1
DIOPT Version :9
Sequence 1: | NP_001285389.1 |
Gene: | unc-4 / 32757 |
FlyBaseID: | FBgn0024184 |
Length: | 588 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_073207.1 |
Gene: | PRRX1 / 5396 |
HGNCID: | 9142 |
Length: | 245 |
Species: | Homo sapiens |
Alignment Length: | 74 |
Identity: | 41/74 - (55%) |
Similarity: | 52/74 - (70%) |
Gaps: | 4/74 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 233 DGD----DDSSAAKRRRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQN 293
|.| ::....|:||:||.|||.||:.|||.|..:||||.|:||.||.|::|.|:||.|||||
Human 80 DNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQN 144
Fly 294 RRAKVRKRE 302
||||.|:.|
Human 145 RRAKFRRNE 153
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.