DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment unc-4 and PRRX1

DIOPT Version :9

Sequence 1:	NP_001285389.1	Gene:	unc-4 / 32757	FlyBaseID:	FBgn0024184	Length:	588	Species:	Drosophila melanogaster
Sequence 2:	NP_073207.1	Gene:	PRRX1 / 5396	HGNCID:	9142	Length:	245	Species:	Homo sapiens

Alignment Length:	74	Identity:	41/74 - (55%)
Similarity:	52/74 - (70%)	Gaps:	4/74 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   233 DGD----DDSSAAKRRRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQN 293
            |.|    ::....|:||:||.|||.||:.|||.|..:||||.|:||.||.|::|.|:||.|||||
Human    80 DNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQN 144

  Fly   294 RRAKVRKRE 302
            ||||.|:.|
Human   145 RRAKFRRNE 153

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
unc-4	NP_001285389.1	Homeobox	246..299	CDD:278475	34/52 (65%)
unc-4	NP_001285389.1	NK	<327..>368	CDD:302627
PRRX1	NP_073207.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..22
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	63..103		8/22 (36%)
		Homeobox	99..151	CDD:395001	33/51 (65%)
		OAR	219..235	CDD:397759
		OAR. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00138	222..235
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910