DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-4 and gsb

DIOPT Version :9

Sequence 1:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster


Alignment Length:148 Identity:53/148 - (35%)
Similarity:81/148 - (54%) Gaps:25/148 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 ASTVATIQHRLMIGNRQS--------LPPAGPPSEGSNEDGGFPGDGDDDSSAA-----KRRRSR 247
            |.:|::|. ||:.|:..|        :...|..|.||.:      :.:||:..:     |:||||
  Fly   132 APSVSSIS-RLLRGSSGSGTSHSIDGILGGGAGSVGSED------ESEDDAEPSVQLKRKQRRSR 189

  Fly   248 TNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVRKREHTKK----GP 308
            |.|::.|::.|||.|:.:.|||::.||.||....|.|:||.|||.||||::||:.:|::    .|
  Fly   190 TTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQVWFSNRRARLRKQLNTQQVPSFAP 254

  Fly   309 GRPAHNAQPQTCSGEPIP 326
            ...:..|.| |.|..|.|
  Fly   255 TSTSFGATP-TTSAAPAP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 27/52 (52%)
NK <327..>368 CDD:302627 53/148 (36%)
gsbNP_523863.1 PAX 19..143 CDD:128645 5/11 (45%)
homeodomain 186..243 CDD:238039 30/56 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450914
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.