DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-4 and CG9876

DIOPT Version :9

Sequence 1:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster


Alignment Length:93 Identity:43/93 - (46%)
Similarity:55/93 - (59%) Gaps:6/93 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 PAGPPSEGSNE----DGGFPGDGDDDSSAAKRRRSRTNFNSWQLEELERAFSASHYPDIFMREAL 276
            |.|....|::.    .|..|..|...|  .|.||:||.|:|.||..||:.|..:||||.|:||.|
  Fly    88 PTGAGCGGADRPAPCSGNLPAGGGHHS--RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREEL 150

  Fly   277 AMRLDLKESRVAVWFQNRRAKVRKREHT 304
            |.::.|.|:||.|||||||||.|:.|.:
  Fly   151 ATKVHLSEARVQVWFQNRRAKFRRNERS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 31/52 (60%)
NK <327..>368 CDD:302627
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 31/51 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450893
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.