DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-4 and Pph13

DIOPT Version :9

Sequence 1:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster


Alignment Length:348 Identity:87/348 - (25%)
Similarity:118/348 - (33%) Gaps:144/348 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 DDDSSAAKRRRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVR 299
            |..:...|:||.||.||:.||:||||||..:||||:|.||.||:|:||.|:||.|||||||||.|
  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66

  Fly   300 KREHTKKGPGRPAHNAQPQTCSGEPIPPNELKAKERARRRKKLAKAIDRQARKLQAKGITVDLEA 364
            |:|                                                 |:...|       
  Fly    67 KQE-------------------------------------------------KIGGLG------- 75

  Fly   365 LKAEYISQHKANGTFSDSDLEDDGIQIDVVGGTDSDDEGDSDAVSPVRLGGGG------------ 417
                             .|.::..:.:| |...||...|..|:.    |||||            
  Fly    76 -----------------GDYKEGALDLD-VSYDDSAVLGQLDSA----LGGGGTLLPDTPPQSSN 118

  Fly   418 ------GGGGGTGGGGGGGASSSL-------HCGLDGDGDSSRAGSFIGGGGSLGSPSSVAPPSM 469
                  ....|||.......|.::       |.||:            .||..|....|..||..
  Fly   119 SLDNELKASYGTGAMSPSRLSPNIFLNLNIDHLGLE------------RGGSGLSMEWSTYPPQT 171

  Fly   470 LSNGAVQFGKLEPMDG-NESEERDRERDSPKPLLFPAKAFHQLNLQSSQQHHGLVVGQGQGSGSG 533
            .:....|      ||. |:.::...::.:..|:...:.:.||   |..||               
  Fly   172 QAQTHPQ------MDSDNQLQQHPPQQHASDPIHAGSSSHHQ---QQQQQ--------------- 212

  Fly   534 HGHGHQHNHHQHHLHHGSASASA 556
                ||...|...||.|...|::
  Fly   213 ----HQQEQHNPQLHPGLEFAAS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 36/52 (69%)
NK <327..>368 CDD:302627 2/40 (5%)
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450917
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.