DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-4 and al

DIOPT Version :9

Sequence 1:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:415 Identity:113/415 - (27%)
Similarity:160/415 - (38%) Gaps:123/415 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 SAAQTTAVAAVASTVATIQHRLMIGNRQSLPPAGPPSEGSNEDGGF---PGDGDDDSSA------ 240
            |||...|...|:.:|:                .|.||..|...||.   ..||:.|..|      
  Fly    34 SAASAGAALTVSMSVS----------------GGAPSGASGASGGTNSPVSDGNSDCEADEYAPK 82

  Fly   241 AKRRRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVRKREHTK 305
            .|:||.||.|.|:||||||:|||.:||||:|.||.|||::.|.|:|:.|||||||||.||:|  |
  Fly    83 RKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQE--K 145

  Fly   306 KGPGRPAHN-------AQPQTCSGEPIPPNELKAKERARRRKKLAKAIDRQARKLQAKGITVDLE 363
            .||....:|       |..||..|..:|||..     .....:|.|..|.|.        ..:|.
  Fly   146 VGPQSHPYNPYLPGGAATMQTVVGAALPPNPF-----THLGFQLRKPFDAQH--------AANLA 197

  Fly   364 ALKAEYISQHK--ANGTFSDSDLEDDGIQIDVVGGTDSDDEGDSDAVSPVRLGGGGGGGGGTGGG 426
            |.:..::|...  .:|.|:                       ......|..|         ..|.
  Fly   198 AFRYPHLSAAPMIPSGYFN-----------------------QFQRAPPHML---------PHGM 230

  Fly   427 GGGGASSSLHCGLDGDGDSSRAGSFIGGGGSL--GSPSSVAPPSMLSNGAVQFGKLEPMDGNESE 489
            .|..:.||....|..:..:...|:.:|...:|  |||...:|..||::...     .|..|:.|:
  Fly   231 AGMYSPSSSFQSLLANMTAVPRGTPLGKPPALLVGSPDLHSPNHMLASPPT-----SPASGHASQ 290

  Fly   490 ERDRERDSPKPLLFPAKAFHQLNLQSSQ---QHHGLVVGQGQGSGSGHGHGHQHNHHQHHLHHGS 551
            .:......|.|...|.:.  .:.:|.:|   ||  ||                          |.
  Fly   291 HQQHPTAHPPPPQAPPQM--PVGVQPAQLSPQH--LV--------------------------GI 325

  Fly   552 ASASAAAAVANLVHQTSPISMRRSN 576
            |....|::::..  ||||:::..|:
  Fly   326 ALTQQASSLSPT--QTSPVALTLSH 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 35/52 (67%)
NK <327..>368 CDD:302627 8/40 (20%)
alNP_722629.1 Homeobox 89..141 CDD:278475 35/51 (69%)
OAR 374..391 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450918
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.