DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-4 and CG11294

DIOPT Version :9

Sequence 1:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001259352.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:306 Identity:75/306 - (24%)
Similarity:110/306 - (35%) Gaps:110/306 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 PGDGDDDSSAAKR--RRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQN 293
            |||...:....:|  ||:||.|...||:|||..|..:||||:|:||.:|:|:.|.|:||.|||||
  Fly    10 PGDLLTEYMFGRRRQRRNRTTFTPQQLQELEALFQKTHYPDVFLREEVALRISLSEARVQVWFQN 74

  Fly   294 RRAKVRKREHTKKGPGRPAHNAQPQTCSGEPIPPNELKAKERARRRKKLAKAIDRQARKLQAKGI 358
            ||||.||                                                |||       
  Fly    75 RRAKWRK------------------------------------------------QAR------- 84

  Fly   359 TVDLEALKAEYISQHKANGTFSDSDLEDDGIQIDVVGGTDSDDEGDSDAVSPVRLGGGGGGGGGT 423
               |:.|:..:..:..:.||                              .||.  |||...||:
  Fly    85 ---LQLLQDAWRMRCLSLGT------------------------------PPVM--GGGAVQGGS 114

  Fly   424 GGGGGGGASSSLHCGLDGDGDSSRAGSFIGGGGSLGSPSSVAPPSMLSNGAVQFGKLEPMDGNES 488
            |.|......|.....|......|.... :|.|.:.||.:.:.|         .|.:......::.
  Fly   115 GNGATARPPSQTPENLSSASKDSELAE-VGNGPNSGSFTMMHP---------AFQQQHQQQQHQG 169

  Fly   489 EERDRERDSPKPLLFPAKAFHQLNLQSSQQHHGLVVGQGQGSGSGH 534
            .::..::|.      .:|.:.:|.|..:.. ||:.:| |..:.|||
  Fly   170 HQQATDQDK------LSKTYTELKLYKAPS-HGMELG-GMAALSGH 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 31/52 (60%)
NK <327..>368 CDD:302627 5/40 (13%)
CG11294NP_001259352.1 Homeobox 29..80 CDD:278475 30/50 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450919
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.